AFF4 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083617
Article Name: |
AFF4 Antibody - middle region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083617 |
Supplier Catalog Number: |
orb2083617 |
Alternative Catalog Number: |
BYT-ORB2083617-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human AFF4 |
Conjugation: |
FITC |
Alternative Names: |
MCEF, CHOPS, AF5Q31 |
AFF4 Antibody - middle region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
38kDa |
UniProt: |
Q9UHB7 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: SSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSL |