ACOX2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083622
Article Name: ACOX2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083622
Supplier Catalog Number: orb2083622
Alternative Catalog Number: BYT-ORB2083622-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACOX2
Conjugation: HRP
Alternative Names: BCOX, BRCOX, CBAS6, THCCox, BRCACOX
ACOX2 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 005265562
UniProt: Q99424
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSK