AATK Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083630
Article Name: AATK Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083630
Supplier Catalog Number: orb2083630
Alternative Catalog Number: BYT-ORB2083630-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AATK
Conjugation: Biotin
Alternative Names: LMR1, AATYK, LMTK1, p35BP, AATYK1, PPP1R77
AATK Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 151kDa
UniProt: Q6ZMQ8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: APNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPA