TAOK1 Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083631
Article Name: TAOK1 Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083631
Supplier Catalog Number: orb2083631
Alternative Catalog Number: BYT-ORB2083631-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
Conjugation: HRP
Alternative Names: PSK2, TAO1, KFC-B, MARKK, PSK-2, hKFC-B, hTAOK1, MAP3K16
TAOK1 Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 43kDa
UniProt: Q7L7X3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ