TAOK1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083633
Article Name: TAOK1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083633
Supplier Catalog Number: orb2083633
Alternative Catalog Number: BYT-ORB2083633-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
Conjugation: Biotin
Alternative Names: PSK2, TAO1, KFC-B, MARKK, PSK-2, hKFC-B, hTAOK1, MAP3K16
TAOK1 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 43kDa
UniProt: Q7L7X3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ