SNX17 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083635
Article Name: |
SNX17 Antibody - middle region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083635 |
Supplier Catalog Number: |
orb2083635 |
Alternative Catalog Number: |
BYT-ORB2083635-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human SNX17 |
Conjugation: |
FITC |
Alternative Names: |
SNX17, KIAA0064, |
SNX17 Antibody - middle region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
51kDa |
NCBI: |
055563 |
UniProt: |
Q15036 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: TSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILV |