SDHD Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083637
| Article Name: |
SDHD Antibody - N-terminal region : HRP, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2083637 |
| Supplier Catalog Number: |
orb2083637 |
| Alternative Catalog Number: |
BYT-ORB2083637-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD |
| Conjugation: |
HRP |
| Alternative Names: |
PGL, CBT1, CWS3, PGL1, QPs3, SDH4, cybS, CII-4, MC2DN3 |
| SDHD Antibody - N-terminal region : HRP |
| Clonality: |
Polyclonal |
| Molecular Weight: |
17kDa |
| NCBI: |
002993 |
| UniProt: |
O14521 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG |
