SDHD Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083638
Article Name: |
SDHD Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083638 |
Supplier Catalog Number: |
orb2083638 |
Alternative Catalog Number: |
BYT-ORB2083638-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD |
Conjugation: |
FITC |
Alternative Names: |
PGL, CBT1, CWS3, PGL1, QPs3, SDH4, cybS, CII-4, MC2DN3 |
SDHD Antibody - N-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
17kDa |
NCBI: |
002993 |
UniProt: |
O14521 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG |