REV1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083642
Article Name: REV1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083642
Supplier Catalog Number: orb2083642
Alternative Catalog Number: BYT-ORB2083642-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1
Conjugation: Biotin
Alternative Names: REV1L, AIBP80
REV1 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 137kDa
NCBI: 005264024
UniProt: Q9UBZ9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA