NDUFA4 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083645
Article Name: NDUFA4 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083645
Supplier Catalog Number: orb2083645
Alternative Catalog Number: BYT-ORB2083645-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NDUFA4
Conjugation: Biotin
Alternative Names: MLRQ, CI-9k, COXFA4, CI-MLRQ, MC4DN21
NDUFA4 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 002480
UniProt: O00483
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF