MPV17 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083647
Article Name: MPV17 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083647
Supplier Catalog Number: orb2083647
Alternative Catalog Number: BYT-ORB2083647-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPV17
Conjugation: FITC
Alternative Names: SYM1, CMT2EE, MTDPS6
MPV17 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 005264383
UniProt: P39210
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPA