MPDU1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083649
Article Name: MPDU1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083649
Supplier Catalog Number: orb2083649
Alternative Catalog Number: BYT-ORB2083649-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPDU1
Conjugation: HRP
Alternative Names: SL15, CDGIF, Lec35, My008, PQLC5, PP3958, SLC66A5, HBEBP2BPA
MPDU1 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 004861
UniProt: O75352
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ