IFNAR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083656
Article Name: IFNAR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083656
Supplier Catalog Number: orb2083656
Alternative Catalog Number: BYT-ORB2083656-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNAR1
Conjugation: FITC
Alternative Names: AVP, IFRC, IFNAR, IFNBR, IFN-alpha-REC
IFNAR1 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 000620
UniProt: P17181
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESK