CHST10 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083665
Article Name: CHST10 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083665
Supplier Catalog Number: orb2083665
Alternative Catalog Number: BYT-ORB2083665-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CHST10
Conjugation: FITC
Alternative Names: HNK1ST, HNK-1ST
CHST10 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 005264131
UniProt: O43529
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIH