ZNF846 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083682
Article Name: ZNF846 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083682
Supplier Catalog Number: orb2083682
Alternative Catalog Number: BYT-ORB2083682-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-ZNF846 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN846
Conjugation: HRP
ZNF846 Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 23 kDa
UniProt: Q147U1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAF