ODF3L2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083687
Article Name: ODF3L2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083687
Supplier Catalog Number: orb2083687
Alternative Catalog Number: BYT-ORB2083687-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ODF3L2
Conjugation: Biotin
Alternative Names: C19orf19
ODF3L2 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 872383
UniProt: Q3SX64
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTV