UBXN8 Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083697
Article Name: UBXN8 Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083697
Supplier Catalog Number: orb2083697
Alternative Catalog Number: BYT-ORB2083697-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UBXN8
Conjugation: HRP
Alternative Names: REP8, UBXD6, D8S2298E
UBXN8 Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 005662
UniProt: O00124
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RKLEERFYQMTGEAWKLSSGHKLGGDEGTSQTSFETSNREAAKSQNLPKP