SDE2 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083708
Article Name: SDE2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083708
Supplier Catalog Number: orb2083708
Alternative Catalog Number: BYT-ORB2083708-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SDE2
Conjugation: Biotin
Alternative Names: C1orf55, dJ671D7.1
SDE2 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 48kDa
UniProt: Q6IQ49
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VSAEISENRKRQWPTKSQTDRGASAGKRRCFWLGMEGLETAEGSNSESSD