CEP78 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083714
Article Name: CEP78 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083714
Supplier Catalog Number: orb2083714
Alternative Catalog Number: BYT-ORB2083714-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEP78
Conjugation: Biotin
Alternative Names: IP63, CRDHL, C9orf81
CEP78 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 115547
UniProt: Q5JTW2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EQRQESFEGFIARMCSPSPDATSGTGSQRKEEELSRNSRSSSEKKTKTES