INTS11 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083719
Article Name: |
INTS11 Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083719 |
Supplier Catalog Number: |
orb2083719 |
Alternative Catalog Number: |
BYT-ORB2083719-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of human CPSF3L |
Conjugation: |
FITC |
Alternative Names: |
RC68, INT11, RC-68, CPSF3L, CPSF73L |
INTS11 Antibody - N-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
22kDa |
NCBI: |
001243385 |
UniProt: |
Q5TA45 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: VMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALP |