MIS18BP1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083723
Article Name: |
MIS18BP1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083723 |
Supplier Catalog Number: |
orb2083723 |
Alternative Catalog Number: |
BYT-ORB2083723-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MIS18BP1 |
Conjugation: |
Biotin |
Alternative Names: |
KNL2, M18BP1, C14orf106, HSA242977 |
MIS18BP1 Antibody - C-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
124kDa |
NCBI: |
005267890 |
UniProt: |
Q6P0N0 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: ECQRKYMENPRGKGSQKHVTKKKPANSKGQNGKRGDADQKQTIKITAKVG |