CDK17 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083725
Article Name: CDK17 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083725
Supplier Catalog Number: orb2083725
Alternative Catalog Number: BYT-ORB2083725-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK17
Conjugation: FITC
Alternative Names: PCTK2, PCTAIRE2
CDK17 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 002586
UniProt: Q00537
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF