JOSD1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086150
Article Name: JOSD1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086150
Supplier Catalog Number: orb2086150
Alternative Catalog Number: BYT-ORB2086150-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human JOSD1
Conjugation: Biotin
Alternative Names: dJ508I15.2
JOSD1 Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 055691
UniProt: Q15040
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAF