IZUMO2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086154
Article Name: |
IZUMO2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086154 |
Supplier Catalog Number: |
orb2086154 |
Alternative Catalog Number: |
BYT-ORB2086154-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IZUMO2 |
Conjugation: |
HRP |
Alternative Names: |
SCRL, C19orf41, PLAL6978, PRO21961 |
IZUMO2 Antibody - C-terminal region : HRP |
Clonality: |
Polyclonal |
Molecular Weight: |
22kDa |
NCBI: |
689571 |
UniProt: |
Q6UXV1 |
Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Sequence: |
Synthetic peptide located within the following region: CIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVV |