IZUMO2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086156
| Article Name: |
IZUMO2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2086156 |
| Supplier Catalog Number: |
orb2086156 |
| Alternative Catalog Number: |
BYT-ORB2086156-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IZUMO2 |
| Conjugation: |
Biotin |
| Alternative Names: |
SCRL, C19orf41, PLAL6978, PRO21961 |
| IZUMO2 Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
22kDa |
| NCBI: |
689571 |
| UniProt: |
Q6UXV1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: CIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVV |
