IQCF6 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086160
Article Name: IQCF6 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086160
Supplier Catalog Number: orb2086160
Alternative Catalog Number: BYT-ORB2086160-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human IQCF6
Conjugation: HRP
IQCF6 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 001137305
UniProt: A8MYZ5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VQAQVRMWQARRRFLQARQAACIIQSHWRWHASQTRGLIRGHYEVRASRL