IQCF6 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086161
Article Name: IQCF6 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086161
Supplier Catalog Number: orb2086161
Alternative Catalog Number: BYT-ORB2086161-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human IQCF6
Conjugation: FITC
IQCF6 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 001137305
UniProt: A8MYZ5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VQAQVRMWQARRRFLQARQAACIIQSHWRWHASQTRGLIRGHYEVRASRL