IQCC Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086164
| Article Name: |
IQCC Antibody - middle region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2086164 |
| Supplier Catalog Number: |
orb2086164 |
| Alternative Catalog Number: |
BYT-ORB2086164-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human IQCC |
| Conjugation: |
FITC |
| Alternative Names: |
RP4-622L5.6 |
| IQCC Antibody - middle region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
61kDa |
| NCBI: |
001153514 |
| UniProt: |
F5H7T8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: ANQGSLCRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQL |
