INTS2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086180
Article Name: |
INTS2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086180 |
Supplier Catalog Number: |
orb2086180 |
Alternative Catalog Number: |
BYT-ORB2086180-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human INTS2 |
Conjugation: |
Biotin |
Alternative Names: |
INT2, KIAA1287 |
INTS2 Antibody - N-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
134kDa |
NCBI: |
065799 |
UniProt: |
Q9H0H0 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL |