INO80C Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086183
Article Name: |
INO80C Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086183 |
Supplier Catalog Number: |
orb2086183 |
Alternative Catalog Number: |
BYT-ORB2086183-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human INO80C |
Conjugation: |
Biotin |
Alternative Names: |
IES6, hIes6, C18orf37 |
INO80C Antibody - N-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
21kDa |
UniProt: |
Q6PI98 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME |