ILDR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086186
Article Name: ILDR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086186
Supplier Catalog Number: orb2086186
Alternative Catalog Number: BYT-ORB2086186-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ILDR2
Conjugation: Biotin
Alternative Names: C1orf32, dJ782G3.1
ILDR2 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 955383
UniProt: Q71H61
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQ