IGSF22 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086193
Article Name: IGSF22 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086193
Supplier Catalog Number: orb2086193
Alternative Catalog Number: BYT-ORB2086193-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IGSF22
Conjugation: HRP
Alternative Names: IGFN2
IGSF22 Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 99kDa
UniProt: Q8N9C0
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: NKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKM