FGFRL1 Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086197
Article Name: FGFRL1 Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086197
Supplier Catalog Number: orb2086197
Alternative Catalog Number: BYT-ORB2086197-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGFRL1
Conjugation: FITC
Alternative Names: FHFR, FGFR5, FGFR-5
FGFRL1 Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 001004356
UniProt: Q8N441
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRSPSA