IGLON5 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086200
Article Name: IGLON5 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086200
Supplier Catalog Number: orb2086200
Alternative Catalog Number: BYT-ORB2086200-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IGLON5
Conjugation: FITC
IGLON5 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001094842
UniProt: A6NGN9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVS