HSD11B1L Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086206
Article Name: |
HSD11B1L Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086206 |
Supplier Catalog Number: |
orb2086206 |
Alternative Catalog Number: |
BYT-ORB2086206-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HSD11B1L |
Conjugation: |
FITC |
Alternative Names: |
HSD3, HSD1L, 11-DH3, SCDR10, SCDR10B, SDR26C2, 11-beta-HSD3 |
HSD11B1L Antibody - C-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
34kDa |
UniProt: |
Q7Z5J1 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: PPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVP |