HSD11B1L Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086207
| Article Name: |
HSD11B1L Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2086207 |
| Supplier Catalog Number: |
orb2086207 |
| Alternative Catalog Number: |
BYT-ORB2086207-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HSD11B1L |
| Conjugation: |
Biotin |
| Alternative Names: |
HSD3, HSD1L, 11-DH3, SCDR10, SCDR10B, SDR26C2, 11-beta-HSD3 |
| HSD11B1L Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
34kDa |
| UniProt: |
Q7Z5J1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: PPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVP |
