HIST1H4A Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086219
Article Name: HIST1H4A Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086219
Supplier Catalog Number: orb2086219
Alternative Catalog Number: BYT-ORB2086219-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H4A
Conjugation: Biotin
Alternative Names: H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, HIST1H4A
HIST1H4A Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 778224
UniProt: P62805
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK