HIST1H4A Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086219
Article Name: |
HIST1H4A Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086219 |
Supplier Catalog Number: |
orb2086219 |
Alternative Catalog Number: |
BYT-ORB2086219-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H4A |
Conjugation: |
Biotin |
Alternative Names: |
H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, HIST1H4A |
HIST1H4A Antibody - N-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
11kDa |
NCBI: |
778224 |
UniProt: |
P62805 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK |