HIST1H2AE Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086222
Article Name: |
HIST1H2AE Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086222 |
Supplier Catalog Number: |
orb2086222 |
Alternative Catalog Number: |
BYT-ORB2086222-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H2AE |
Conjugation: |
Biotin |
Alternative Names: |
H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE |
HIST1H2AE Antibody - N-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
14kDa |
NCBI: |
066390 |
UniProt: |
P04908 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA |