HIGD2A Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086224
Article Name: HIGD2A Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086224
Supplier Catalog Number: orb2086224
Alternative Catalog Number: BYT-ORB2086224-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIGD2A
Conjugation: FITC
Alternative Names: RCF1b
HIGD2A Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 620175
UniProt: Q9BW72
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGN