HAUS2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086248
Article Name: HAUS2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086248
Supplier Catalog Number: orb2086248
Alternative Catalog Number: BYT-ORB2086248-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAUS2
Conjugation: FITC
Alternative Names: CEP27, C15orf25, HsT17025
HAUS2 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 060567
UniProt: Q9NVX0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI