GUCY1A2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086252
Article Name: |
GUCY1A2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086252 |
Supplier Catalog Number: |
orb2086252 |
Alternative Catalog Number: |
BYT-ORB2086252-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GUCY1A2 |
Conjugation: |
Biotin |
Alternative Names: |
GC-SA2, GUC1A2 |
GUCY1A2 Antibody - N-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
81kDa |
NCBI: |
001243353 |
UniProt: |
P33402 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF |