GRXCR2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086257
Article Name: GRXCR2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086257
Supplier Catalog Number: orb2086257
Alternative Catalog Number: BYT-ORB2086257-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GRXCR2
Conjugation: FITC
Alternative Names: DFNB101
GRXCR2 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 001073985
UniProt: A6NFK2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PLVEAESTLPQNRYTQEGDIPEDSCFHCRGSGSATCSLCHGSKFSMLANR