GREB1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086263
Article Name: GREB1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086263
Supplier Catalog Number: orb2086263
Alternative Catalog Number: BYT-ORB2086263-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GREB1
Conjugation: FITC
GREB1 Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 683701
UniProt: Q4ZG55
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYLVRNAQGT