GPR89A Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086275
Article Name: |
GPR89A Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086275 |
Supplier Catalog Number: |
orb2086275 |
Alternative Catalog Number: |
BYT-ORB2086275-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR89A |
Conjugation: |
FITC |
Alternative Names: |
GPHR, GPR89, SH120, GPR89B, UNQ192 |
GPR89A Antibody - C-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
53kDa |
NCBI: |
057418 |
UniProt: |
B7ZAQ6 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM |