GOLPH3L Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086281
Article Name: GOLPH3L Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086281
Supplier Catalog Number: orb2086281
Alternative Catalog Number: BYT-ORB2086281-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GOLPH3L
Conjugation: FITC
Alternative Names: GPP34R
GOLPH3L Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 060648
UniProt: Q9H4A5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKE