GLIPR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086298
Article Name: GLIPR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086298
Supplier Catalog Number: orb2086298
Alternative Catalog Number: BYT-ORB2086298-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GLIPR2
Conjugation: HRP
Alternative Names: GAPR1, GAPR-1, C9orf19
GLIPR2 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 071738
UniProt: Q9H4G4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSS