GLIPR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086300
Article Name: GLIPR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086300
Supplier Catalog Number: orb2086300
Alternative Catalog Number: BYT-ORB2086300-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GLIPR2
Conjugation: Biotin
Alternative Names: GAPR1, GAPR-1, C9orf19
GLIPR2 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 071738
UniProt: Q9H4G4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSS