GLB1L3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086303
Article Name: GLB1L3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086303
Supplier Catalog Number: orb2086303
Alternative Catalog Number: BYT-ORB2086303-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GLB1L3
Conjugation: Biotin
GLB1L3 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 001073876
UniProt: Q8NCI6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKA