GAB4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086314
Article Name: GAB4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086314
Supplier Catalog Number: orb2086314
Alternative Catalog Number: BYT-ORB2086314-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAB4
Conjugation: FITC
GAB4 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 001032903
UniProt: Q2WGN9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GTSSSAPPRSTGNIHYAALDFQPSKPSIGSVTSGKKVDYVQVDLEKTQAL