FNDC7 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086324
Article Name: FNDC7 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086324
Supplier Catalog Number: orb2086324
Alternative Catalog Number: BYT-ORB2086324-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FNDC7
Conjugation: Biotin
Alternative Names: RP11-293A10.2
FNDC7 Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 001138409
UniProt: Q5VTL7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PGTVTGLKAATWYEITIRSISAAGRSQASPPKQAKTVLAAPILEVSSPSS